PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 81aa    MW: 9672.13 Da    PI: 10.7438
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544429.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.7e-103171345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +++ eE++l+ + +k+ G + W++Ia +++ gRt++++  +w 
   XP_010544429.1 31 NMSREEEDLICRMHKLVGDR-WELIAGRIP-GRTAEEIERFWI 71
                     5789**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.6E-92876IPR001005SANT/Myb domain
CDDcd001672.49E-63170No hitNo description
PfamPF002494.6E-93271IPR001005SANT/Myb domain
PROSITE profilePS500906.263370IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.0E-123371IPR009057Homeodomain-like
SuperFamilySSF466893.43E-83371IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010026Biological Processtrichome differentiation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MDKRRKKQPK PNRPVASSSE EVSSIGWEVV NMSREEEDLI CRMHKLVGDR WELIAGRIPG  60
RTAEEIERFW IMKNHRRSQL R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195183e-46AY519518.1 Arabidopsis thaliana MYB transcription factor (At1g01380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544429.13e-53PREDICTED: MYB-like transcription factor ETC3
SwissprotO220592e-32CPC_ARATH; Transcription factor CPC
TrEMBLV4MWM42e-36V4MWM4_EUTSA; Uncharacterized protein
STRINGAT4G01060.14e-34(Arabidopsis thaliana)
STRINGfgenesh1_pm.C_scaffold_60028923e-34(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.23e-33CAPRICE-like MYB3